PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03036.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 236aa    MW: 26447.6 Da    PI: 8.9544
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03036.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
  Rsa1.0_03036.1_g00002.1 14 KGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINYL 61
                             79******************************99************97 PP

2Myb_DNA-binding54.33.1e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+++ eEd+ +++++ +lG++ W++Ia +++ gRt++++k++w+++
  Rsa1.0_03036.1_g00002.1  67 RGNFSDEEDQVIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.925961IPR017930Myb domain
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
SuperFamilySSF466895.39E-2913108IPR009057Homeodomain-like
PfamPF002492.6E-161461IPR001005SANT/Myb domain
CDDcd001674.24E-111661No hitNo description
PROSITE profilePS5129427.96562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2765116IPR009057Homeodomain-like
SMARTSM007174.1E-1666114IPR001005SANT/Myb domain
PfamPF002492.5E-1567111IPR001005SANT/Myb domain
CDDcd001671.22E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR NHGEGCWRSL PKSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SDEEDQVIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSHG  120
IDPQTHRPVK DNVAVTDAKT ASSRLTTTVI VSPQNDTVEY AFIVKPKTEN SSDNGASTSS  180
TTTDEDLRQN GDSYYRDHSG DMELNLDLTL GSGSGSTSWV GSKPWRDTAM AARLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
1h8a_C4e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU269361e-127U26936.1 Arabidopsis thaliana clone myb6 DNA-binding protein mRNA, complete cds.
GenBankAY0868131e-127AY086813.1 Arabidopsis thaliana clone 28019 mRNA, complete sequence.
GenBankAY5196041e-127AY519604.1 Arabidopsis thaliana MYB transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0041711e-127BT004171.1 Arabidopsis thaliana clone RAFL15-40-D03 (R20880) putative myb family transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0050851e-127BT005085.1 Arabidopsis thaliana clone U20880 putative myb family transcription factor (At4g09460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397190.11e-140hypothetical protein EUTSA_v10028861mg
SwissprotQ388511e-135MYB6_ARATH; Transcription repressor MYB6
TrEMBLV4LFW21e-139V4LFW2_EUTSA; Uncharacterized protein
STRINGAT4G09460.11e-132(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-131myb domain protein 6